DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG4653

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:260 Identity:81/260 - (31%)
Similarity:119/260 - (45%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAA 70
            :||..|:..| |.|....||           ..:.|.|..|||:|:|.|.|||::.....|:|||
  Fly    12 LLLLVVIVTL-GVVQSSRLP-----------AEVGSQPHSISLRRNGVHVCGGALIREKWILTAA 64

  Fly    71 HCL------QSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMV--NDIAVIRLSSSLS 127
            ||:      ||..|....||.||....:||.:..:|....|..|:::..|  ||:|::.|.:|:.
  Fly    65 HCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVV 129

  Fly   128 FSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192
            .:::...|.|||..||.|:....||||: |....|:...||......:|.|.|.:..|    ..:
  Fly   130 LNANTNPIDLATERPAAGSQIIFSGWGS-SQVDGSLSHVLQVATRQSLSASDCQTELY----LQQ 189

  Fly   193 NTMICAAASGKD---ACQGDSGGPLVSGGVLVGVVSWGY-GCAYSNYPGVYADVAVLRSWVVSTA 253
            ..::|.:...:|   .|.||:|.|......|||:.::.. ||. |..|..|.||.....|:...|
  Fly   190 EDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCG-SEQPDGYVDVTQHLEWINENA 253

  Fly   254  253
              Fly   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 71/230 (31%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 73/238 (31%)
Tryp_SPc 30..249 CDD:214473 72/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.