DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG9673

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:243 Identity:83/243 - (34%)
Similarity:123/243 - (50%) Gaps:29/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQS-----VSASVLQVR 84
            ||  |||:||.......:||..|::.:.:|.|.|:|.|.|.|:|||||:.|     |.||.|.||
  Fly    25 PQ--GRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVR 87

  Fly    85 AGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNP------- 142
            .|:....:||.:..|.|...|..|  ...::|||::.|..:|.||..|:.|:|.....       
  Fly    88 LGTINQYAGGSIVNVKSVIIHPSY--GNFLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVD 150

  Fly   143 ---ANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCA-SSTYGYGSQIRNTMIC-AAASG 202
               .||....|:|||..|.|::|.  :.|..|.|.:|:|.|. .:.|||.|     ::| :.|.|
  Fly   151 AELPNGTPVYVAGWGELSDGTASY--KQQKANYNTLSRSLCEWEAGYGYES-----VVCLSRAEG 208

  Fly   203 KDACQGDSGGPLVSGG-VLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            :..|:||:|..::... ||.|:.|:.:|...|.||.|...|:...:|:
  Fly   209 EGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 79/236 (33%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 79/236 (33%)
Tryp_SPc 29..259 CDD:238113 79/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.