DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and sphe

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:248 Identity:79/248 - (31%)
Similarity:124/248 - (50%) Gaps:19/248 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCL-- 73
            |:..|.|....|:. ...|||:||.....::..:..||:...:|.|||||.|...|:|.|||:  
  Fly     7 VILGLIGLTAVGMC-HAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHR 70

  Fly    74 --QSVSASVLQVRAGSTYWSSGGVVAKVSSFKNH-EGYNANTMVNDIAVIRLSSSLSFSSSIKAI 135
              :.:.||.|..|.|||...:||.:..|.|...| :.||.|   |::|||.|||.|:::..|.||
  Fly    71 DGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNLN---NNLAVITLSSELTYTDRITAI 132

  Fly   136 SLATYN---PANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMIC 197
            .|....   ||.|:...|:|||..|.|::|.  :::.:::.:..::.|..:...:..|    ..|
  Fly   133 PLVASGEALPAEGSEVIVAGWGRTSDGTNSY--KIRQISLKVAPEATCLDAYSDHDEQ----SFC 191

  Fly   198 AAASGKD-ACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            .|...|: .|.||.||..:.|..|:|:.::..|...|.||.|:..::....|:
  Fly   192 LAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 73/227 (32%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 70/212 (33%)
Tryp_SPc 42..244 CDD:214473 69/210 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.