DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG9676

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:253 Identity:105/253 - (41%)
Similarity:143/253 - (56%) Gaps:21/253 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVCALGGTVPEGLLPQLDG----RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAH 71
            |:||      .|:|.|.|.    |||||:......||.||||:|.|||:|||||.|.:.:|||||
  Fly    10 VLCA------AGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAH 68

  Fly    72 CLQS----VSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSI 132
            |::.    ..|:.|:::|||...|||||...|::...|..||:|.  :|:||:||.:||:|:|:|
  Fly    69 CVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNG--HDVAVLRLRNSLTFNSNI 131

  Fly   133 KAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMIC 197
            .||.|||.:|.|.|:..:||||..|. ...|.:.|.||.|..:|:..|..:   |..|:..|.:|
  Fly   132 AAIKLATEDPPNDATVDISGWGAISQ-RGPISNSLLYVQVKALSRESCQKT---YLRQLPETTMC 192

  Fly   198 AA-ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTAN 254
            .. ...|.||.||||||....|.|||:.|:..|......|..|..|:.||:|:...|:
  Fly   193 LLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEKAS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 96/223 (43%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 96/223 (43%)
Tryp_SPc 28..248 CDD:238113 96/225 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.