DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG33159

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:217 Identity:81/217 - (37%)
Similarity:120/217 - (55%) Gaps:4/217 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAG-STYWSSG 93
            |||||..||||..|:.:.|:::|...||||:.|:..:::||||:.........|.|| |......
  Fly    25 RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGASRLDQEA 89

  Fly    94 GVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFS-SSIKAISLATYNPANGASAAVSGWGTQS 157
            .||..|..|.....|:|.....|:|:::|...:..: ..:..||.....|...|.|.:||||...
  Fly    90 PVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPPEGNAYARISGWGVTR 154

  Fly   158 SGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAASG-KDACQGDSGGPLVSGGVLV 221
            ..:.....|::...|.::..::|..|..||| |:.::|:|||..| :|:|.||||||||..|.:.
  Fly   155 ENNREPAEQVRTTMVRVLPGAECKISYSGYG-QLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVC 218

  Fly   222 GVVSWGYGCAYSNYPGVYADVA 243
            |:||||:|||..::||||.:||
  Fly   219 GIVSWGFGCARPSFPGVYTNVA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 81/217 (37%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 81/217 (37%)
Tryp_SPc 26..251 CDD:238113 80/216 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.