DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG32808

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:242 Identity:87/242 - (35%)
Similarity:134/242 - (55%) Gaps:21/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISLQR--SGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYW 90
            ||:||.|:......||:.:||:|  ||.||||.::.:...::|||||::..|...|.::.||...
  Fly    27 DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQML 91

  Fly    91 S-SGGVVAKVSSFKNHEGYN-ANTMVNDIAVIRLSSSLSFSSSIKAISL---ATYNPANGASAAV 150
            : :...||:|::...|.||. .:..|||||:::|:.|::.|..::.:.|   ....|.| |||.:
  Fly    92 ARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGN-ASAVL 155

  Fly   151 SGWGTQSSGSSSIPSQLQYVNVNIVSQSQCAS--STYGYGSQIRNTMICAA--ASGKDACQGDSG 211
            :|||..::| ..:...||.|.:.:.|.::|:.  .||.:.||     |||.  ..||..|.||||
  Fly   156 AGWGLNATG-GVVQQHLQKVKLQVFSDTECSERHQTYLHDSQ-----ICAGLPEGGKGQCSGDSG 214

  Fly   212 GP--LVSGGVLVGVVSWGY-GCAYSNYPGVYADVAVLRSWVVSTANS 255
            ||  |:.....||:|||.. .||...:|||:.:|:....|:|.|.||
  Fly   215 GPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 80/232 (34%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 80/232 (34%)
Tryp_SPc 30..258 CDD:238113 82/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
44.020

Return to query results.
Submit another query.