DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG32755

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:255 Identity:88/255 - (34%)
Similarity:128/255 - (50%) Gaps:39/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PEGLLPQLDGRIVGGSATTISSFPWQISLQRSG--------SHSCGGSIYSANIIVTAAHCLQSV 76
            |..:||    :||||...||...|:|:|::|..        .|.|||::.|..::.:|||| .::
  Fly    31 PFVILP----KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC-YAI 90

  Fly    77 SASV-LQVRAGSTYWSSGGVVA-----------KVSSFKNHEGYNANTMVNDIAVIRLSSSLSFS 129
            :.|| |..|....|....|..|           .|.....|:.||.:|:.||||::.|:..:.:.
  Fly    91 NTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWE 155

  Fly   130 S-SIKAISLATYNPANGASAAVSGWG--TQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI 191
            | .::||.||...|..|.:..:.|||  |....|:|    ||...|.|:::..| ...|    ::
  Fly   156 SPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSAS----LQQAPVPILNKELC-QVIY----KL 211

  Fly   192 RNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            ..:.:||.  ..|.|||||||||||:..|.|.|::|||.|||...|||||.:|:....|:
  Fly   212 PASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 84/243 (35%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 84/243 (35%)
Tryp_SPc 38..273 CDD:238113 85/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.