DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk15

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:266 Identity:84/266 - (31%)
Similarity:124/266 - (46%) Gaps:39/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTVPEGLLPQLDG-RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSAN 64
            :|..|:|:||.               .|| :::.|......|.|||::|...|..:||..:.|..
Mouse     4 LLAFVLLVSAA---------------QDGDKVLEGEECVPHSQPWQVALFERGRFNCGAFLISPR 53

  Fly    65 IIVTAAHCLQSVSASVLQVRAGS---TYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSL 126
            .::|||||    ....::||.|.   ..:.....:..||....|.||.|.|..:||.::||....
Mouse    54 WVLTAAHC----QTRFMRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRLFKPA 114

  Fly   127 SFSSSIKAISLATYNPANGASAAVSGWGTQS------SGSSS----IPSQLQYVNVNIVSQSQCA 181
            ..::.::.::|....|..|....|||||..|      :||..    :|..|...|::|:|::.|.
Mouse   115 RLTAYVRPVALPRRCPLIGEDCVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISEASCN 179

  Fly   182 SSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVA 243
            ..   |..::..||:||.  ..|.|:|:||||||||.||.|.|:|||| ..|..:..||||..|.
Mouse   180 KD---YPGRVLPTMVCAGVEGGGTDSCEGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTKVC 241

  Fly   244 VLRSWV 249
            ....|:
Mouse   242 SYLEWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 76/234 (32%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.