DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss40

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001101679.1 Gene:Prss40 / 316318 RGDID:1561330 Length:376 Species:Rattus norvegicus


Alignment Length:273 Identity:85/273 - (31%)
Similarity:121/273 - (44%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIV 67
            |..:.|| :||  |.|       |..|:|.||.......:|||.||:..|.|.||..:...|.:.
  Rat    53 KTTLSLS-MVC--GKT-------QFQGKIYGGQIAGAQRWPWQASLRLYGRHICGAVLIDKNWVA 107

  Fly    68 TAAHCLQ-SVSASVLQVRAGSTYWSSGGVVAKVSSFKN---HEGYNA-NTMVNDIAVIRLSSSLS 127
            :||||.| |.:....|:..|.|..:|....::..|.|.   |:.||. ....:||.:::|.||:.
  Rat   108 SAAHCFQMSRNPGDYQIMLGYTKLNSPTRYSRKMSVKKLIVHKDYNKFYPQGSDIVLLQLHSSVE 172

  Fly   128 FSSSIKAISLATYN---PANGASAAVSGWGT-QSSGSSSIPSQLQYVNVNIVSQSQC-------- 180
            :||.|....:...|   |...| ...||||. :......:|:.|....:.|:|...|        
  Rat   173 YSSHILPACVPNKNITIPKEKA-CWTSGWGNLREDVRLPLPNDLYEAELIIMSNDDCKGFFPPPV 236

  Fly   181 --ASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYS-NYP 236
              :|.||    .|.:.|:|||  :..|..|.||||||||    ....:||:.||...|... :.|
  Rat   237 PGSSKTY----YIYDDMVCAADYSLTKSICSGDSGGPLVCLLEGSWYVVGLTSWSSSCEDPISSP 297

  Fly   237 GVYADVAVLRSWV 249
            .|:|.|:....|:
  Rat   298 SVFARVSYFDKWI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 75/244 (31%)
Prss40NP_001101679.1 Tryp_SPc 70..310 CDD:214473 75/244 (31%)
Tryp_SPc 71..313 CDD:238113 76/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.