DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prtn3

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:243 Identity:72/243 - (29%)
Similarity:114/243 - (46%) Gaps:37/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRS---GSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWS 91
            :||||......|.|:..|||.|   |||.|||::.....::|||||||.:|..::.|..|:....
  Rat   197 KIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLTAAHCLQDISWQLVTVVLGAHDLL 261

  Fly    92 SGG------VVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNP--ANGASA 148
            |..      .:.:|  |:|:  ||....:||:.:::|:...|....:...||...:.  :.|...
  Rat   262 SSEPEQQKFTITQV--FENN--YNPEETLNDVLLLQLNRPASLGKQVAVASLPQQDQSLSQGTQC 322

  Fly   149 AVSGWGTQSSGSSSIPSQLQYVNVNIVS-----QSQCASSTYGYGSQIRNTMICAAASGKDACQG 208
            ...|||...:.:.: |..|..:||.:|:     .:.|             |::...|:|  .|.|
  Rat   323 LAMGWGRLGTRAPT-PRVLHELNVTVVTFLCREHNVC-------------TLVPRRAAG--ICFG 371

  Fly   209 DSGGPLVSGGVLVGVVSWGY-GCAYSNYPGVYADVAVLRSWVVSTANS 255
            ||||||:..|:|.||.|:.. .||...:|..:|.|::..:|:.|...|
  Rat   372 DSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVNWIHSVLRS 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 69/235 (29%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 70/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.