DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and LOC312273

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:256 Identity:98/256 - (38%)
Similarity:129/256 - (50%) Gaps:19/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANII 66
            :||.|..:     |.|||........|.|||||......|.|:|:|| .:|||.||||:.:...:
  Rat     1 MKICIFFT-----LLGTVAAFPTEDNDDRIVGGYTCQEHSVPYQVSL-NAGSHICGGSLITDQWV 59

  Fly    67 VTAAHCLQSVSASVLQVRAGS-TYWSSGGVVAKVSSFKN--HEGYNANTMVNDIAVIRLSSSLSF 128
            ::||||..    ..||||.|. ..:...|....:.:.|.  |..|:..|:.|||.:|:|.|..:.
  Rat    60 LSAAHCYH----PQLQVRLGEHNIYEIEGAEQFIDAAKMILHPDYDKWTVDNDIMLIKLKSPATL 120

  Fly   129 SSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRN 193
            :|.:..|.|..|.|..|....|||||....|..| ||.||.::..::|.|.|..:   |..||.|
  Rat   121 NSKVSTIPLPQYCPTAGTECLVSGWGVLKFGFES-PSVLQCLDAPVLSDSVCHKA---YPRQITN 181

  Fly   194 TMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVST 252
            .|.|..  ..|||:||.|||||:|..|.:.|:||||.|||....||||..|....:|:..|
  Rat   182 NMFCLGFLEGGKDSCQYDSGGPVVCNGEVQGIVSWGDGCALEGKPGVYTKVCNYLNWIHQT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 88/223 (39%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 88/225 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.