DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Tmprss11e

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038948843.1 Gene:Tmprss11e / 305265 RGDID:1561698 Length:444 Species:Rattus norvegicus


Alignment Length:243 Identity:82/243 - (33%)
Similarity:118/243 - (48%) Gaps:27/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYW 90
            |...|||||::.....:|||.|||..|||.||.::.|...:|:||||.::       .:..|.:.
  Rat   208 QTSVRIVGGTSAEEGEWPWQSSLQWDGSHRCGATLISNTWLVSAAHCFRT-------HKDPSRWT 265

  Fly    91 SSGGVVAKVSSFKN-------HEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL--ATYNPANGA 146
            :|.|...:......       ||.||..:...|||::.||..:..::::..:.|  |.:....|.
  Rat   266 ASFGATLQPPKLTTGIRRIIVHEKYNYPSHDYDIALVELSRPVPCTNAVHKVCLPDANHEFQPGQ 330

  Fly   147 SAAVSGWGT-QSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQG 208
            ...|:|:|. ::.|.:.  :.|:.|.|:.:....| :....|...|...|:||.  ...||||||
  Rat   331 RMFVTGFGALRNDGFAQ--NYLRQVQVDYIDTQTC-NRPQSYNGAITPRMLCAGFLKGEKDACQG 392

  Fly   209 DSGGPLVSGGV-----LVGVVSWGYGCAYSNYPGVYADVAVLRSWVVS 251
            |||||||:..|     |.||||||..|...|.||||..|...|.|:.|
  Rat   393 DSGGPLVTPDVRDVWYLAGVVSWGDECGQPNKPGVYTRVTAFRDWITS 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 79/235 (34%)
Tmprss11eXP_038948843.1 SEA 71..176 CDD:396113
Tryp_SPc 213..441 CDD:238113 80/238 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.