DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss42

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:241 Identity:85/241 - (35%)
Similarity:134/241 - (55%) Gaps:19/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGG 94
            :|:||.......:|||:||:....|.||||:.::..::|||||:.|.....:::...|.|..:..
  Rat    83 KIMGGVDAEEGKWPWQVSLRVRHMHVCGGSLLNSQWVLTAAHCIHSRVQYNVKMGDRSVYRQNTS 147

  Fly    95 VVAKVSSFKNHEGYNANTMV-NDIAVIRLSSSLSFSSSIKAISL--ATYNPANGASAAVSGWGTQ 156
            :|..:.:...|..::..|:| ||||:::|...::|:|||..|.:  .|::...|....|:|||..
  Rat   148 LVIPIQNIFVHPKFSTTTVVQNDIALLKLQQPVNFTSSIHPICVPTGTFHVKAGTKCWVTGWGKP 212

  Fly   157 SSGSSSIPSQ-LQYVNVNIVSQSQC-------ASSTYGYGSQIRNTMICA-AASGKDACQGDSGG 212
            ..|:..||:: ||.|:.:|:...:|       ||::.   ..::..|:|| ...|||||||||||
  Rat   213 DPGAPQIPTEILQEVDQSIILYEECNEMLKKMASTSV---DLVKRGMVCAYKEGGKDACQGDSGG 274

  Fly   213 PLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTAN 254
            ||.    :..|.:||||||.||....:||||.|||....|:::..|
  Rat   275 PLSCEFDNRWVQIGVVSWGIGCGRKGHPGVYTDVAFYNKWLITVVN 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 83/234 (35%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 83/233 (36%)
Tryp_SPc 84..315 CDD:238113 83/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.