DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk1c12

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_017444409.1 Gene:Klk1c12 / 292855 RGDID:1303192 Length:262 Species:Rattus norvegicus


Alignment Length:273 Identity:83/273 - (30%)
Similarity:123/273 - (45%) Gaps:32/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANII 66
            |:|:.|..:|     |.:...  |....|:|||.....:|.|||:::  ...:.|||.:...:.:
  Rat     3 LQILFLFLSV-----GRIDAA--PPGQSRVVGGYKCEKNSQPWQVAV--INRYLCGGVLIDPSWV 58

  Fly    67 VTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKV----SSF----------KNHEGYNANTMVNDI 117
            :||||| .|.:.|...|..|..........|:.    .||          |||..:..:...||:
  Rat    59 ITAAHC-YSHALSNYHVLLGRNNLFKDEPFAQYRFVNQSFPHPDYNPFFMKNHTLFPGDDHSNDL 122

  Fly   118 AVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCAS 182
            .::.||.....:..:|.|.|.|..|..|::...|||.:........|..||.||:||:|..:|..
  Rat   123 MLLHLSEPADITDGVKVIDLPTEEPKVGSTCLASGWSSTKPLEWEFPDDLQCVNINILSNEKCIK 187

  Fly   183 STYGYGSQIRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSW-GYGCAYSNYPGVYADVAV 244
            :   :...:.:.|:||.  ..|||.|.|||||||:..|||.|:.|| ...|..:|.|.:|..:..
  Rat   188 A---HTQMVTDVMLCAGELEGGKDTCNGDSGGPLLCDGVLQGITSWSSVPCGETNRPAIYTKLIK 249

  Fly   245 LRSWV--VSTANS 255
            ..||:  |...||
  Rat   250 FTSWIKEVMKENS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 73/235 (31%)
Klk1c12XP_017444409.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.