DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk7

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:239 Identity:74/239 - (30%)
Similarity:111/239 - (46%) Gaps:35/239 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHC-------------LQSVSASVL 81
            ||:.|......|.|||::|.:.....|||.:...:.::|||||             ::..||.  
  Rat    25 RIIDGYKCKEGSHPWQVALLKGDQLHCGGVLVGESWVLTAAHCKMGQYTVHLGSDKIEDQSAQ-- 87

  Fly    82 QVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGA 146
            :::|..::              .|.||:..|.||||.::::...:..|..::.:.|..:....|.
  Rat    88 RIKASRSF--------------RHPGYSTRTHVNDIMLVKMDKPVKMSDKVQKVKLPDHCEPPGT 138

  Fly   147 SAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAA--SGKDACQGD 209
            ...||||||.:|...:.||.|...:|.::|..:|...   |...:..||:||..  |..:.|.||
  Rat   139 LCTVSGWGTTTSPDVTFPSDLMCSDVKLISSQECKKV---YKDLLGKTMLCAGIPDSKTNTCNGD 200

  Fly   210 SGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAVLRSWVVST 252
            ||||||....|.|:|||| |.|...|.||||..|...:.|:..|
  Rat   201 SGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYQRWLEDT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 72/234 (31%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 72/233 (31%)
Tryp_SPc 26..244 CDD:238113 72/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.