DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk9

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:235 Identity:78/235 - (33%)
Similarity:112/235 - (47%) Gaps:17/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTY--- 89
            |.|.||......:|.|||..|.......||.::.:...::|||||.:    ..|.||.|..:   
  Rat    20 DTRAVGARECQRNSQPWQAGLFYLTRQLCGATLINDQWLLTAAHCRK----PYLWVRLGEHHLWQ 80

  Fly    90 WSSGGVVAKVSSFKNHEGYN----ANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAV 150
            |.....:..|:.|..|.|:|    ||...:||.:|||...:..|.:::.::|:...|:.|....:
  Rat    81 WEGPEKLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKVRLSPAVQPLNLSQSLPSVGTQCLI 145

  Fly   151 SGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGP 213
            ||||:.||.....|..||..|::|:....|   .:.|...|...|:||.  ..|:.:||||||||
  Rat   146 SGWGSVSSSKIQFPMTLQCANISILDNKLC---RWAYPGHISEKMLCAGLWEGGRGSCQGDSGGP 207

  Fly   214 LVSGGVLVGVVSWG-YGCAYSNYPGVYADVAVLRSWVVST 252
            ||..|.|.|:||.| ..|:....|.||..|.....|:.:|
  Rat   208 LVCKGTLAGIVSGGSEPCSRPQRPAVYTSVFHYLDWIENT 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 75/228 (33%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 75/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.