DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Tpsb2

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:270 Identity:95/270 - (35%)
Similarity:132/270 - (48%) Gaps:25/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTVPEGLLP--QLDGRIVGGSATTISSFPWQISLQRSGS---HSCGGSI 60
            |||:::||:  :..|...|.....|  |..| ||||...:.|.:|||:||:...|   |.||||:
  Rat     1 MLKLLLLLA--LSPLASLVHAAPCPVKQRVG-IVGGREASESKWPWQVSLRFKFSFWMHFCGGSL 62

  Fly    61 YSANIIVTAAHC--LQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLS 123
            .....::|||||  |...|..:.:|:....|......:..|:....|..|.......|||::.|.
  Rat    63 IHPQWVLTAAHCVGLHIKSPELFRVQLREQYLYYADQLLTVNRTVVHPHYYTVEDGADIALLELE 127

  Fly   124 SSLSFSSSIKAISL--ATYNPANGASAAVSGWGTQSSGSSSIPS-QLQYVNVNIVSQSQCASSTY 185
            :.::.|:.|...||  |:....:|.|..|:|||...|....:|. .|:.|.|.||..|.| ...|
  Rat   128 NPVNVSTHIHPTSLPPASETFPSGTSCWVTGWGDIDSDEPLLPPYPLKQVKVPIVENSLC-DRKY 191

  Fly   186 GYGSQ-------IRNTMICAAASGKDACQGDSGGPL---VSGGVL-VGVVSWGYGCAYSNYPGVY 239
            ..|..       :::.|:||..:..|:|||||||||   |.|..| .||||||.|||.:|.||:|
  Rat   192 HTGLYTGDDVPIVQDGMLCAGNTRSDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAEANRPGIY 256

  Fly   240 ADVAVLRSWV 249
            ..|.....|:
  Rat   257 TRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 84/237 (35%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 85/238 (36%)
Tryp_SPc 30..266 CDD:214473 84/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.