DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk6

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_062048.1 Gene:Klk6 / 29245 RGDID:3419 Length:251 Species:Rattus norvegicus


Alignment Length:226 Identity:75/226 - (33%)
Similarity:106/226 - (46%) Gaps:15/226 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQ---SVSASVLQVRAGSTYWS 91
            ::|.|.....:|.|:|.:|..||...|||.:.....::|||||.:   .|......:|...|:..
  Rat    28 KVVHGGPCLKNSHPFQAALYTSGHLLCGGVLVGPQWVLTAAHCKKPNLEVYLGKHNLRQTETFQR 92

  Fly    92 SGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGWGTQ 156
            ...|...:.    |..||..|..|||.::.|...:.||..|:.:.|............:.|||..
  Rat    93 QISVDRTIV----HPRYNPQTHDNDIMMVHLKRPVKFSQRIQPLPLKKDCSEKNPDCQILGWGKM 153

  Fly   157 SSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPLVSGGV 219
            .:|  ..|..:|..:|.:||:.:|..:   |..:|..:|:||.  ..|.|:||||||||||.||.
  Rat   154 ENG--EFPDTIQCADVQLVSREECERA---YPGKITRSMVCAGDKREGNDSCQGDSGGPLVCGGH 213

  Fly   220 LVGVVSWG-YGCAYSNYPGVYADVAVLRSWV 249
            |.|:|||| ..|.....||||.||.....|:
  Rat   214 LRGIVSWGDMPCGSKEKPGVYTDVCTHIRWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 74/224 (33%)
Klk6NP_062048.1 Tryp_SPc 28..244 CDD:214473 74/224 (33%)
Tryp_SPc 29..247 CDD:238113 75/225 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.