DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Habp2

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001001505.2 Gene:Habp2 / 292126 RGDID:1302979 Length:558 Species:Rattus norvegicus


Alignment Length:248 Identity:83/248 - (33%)
Similarity:114/248 - (45%) Gaps:32/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRS--------GSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAG 86
            ||.||..:|....|||:|||.|        ..|.||||:.....::||||| ..:|...|:|..|
  Rat   311 RIYGGFKSTAGKHPWQVSLQTSLPLTTSMPQGHFCGGSLIHPCWVLTAAHC-TDMSTKHLKVVLG 374

  Fly    87 S---TYWSSGGVVAKVSSFKNHEGYNANTMV--NDIAVIRLS-----SSLSFSSSIKAISLATYN 141
            .   ....|.....:|.....:..||....:  ||||:::|.     .:|. |..:|.:.|.:..
  Rat   375 DQDLKKTESHEQTFRVEKILKYSQYNERDEIPHNDIALLKLKPVGGHCALE-SKYVKTVCLPSDP 438

  Fly   142 PANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA---ASGK 203
            ..:|....:||||...:|..|  .||....|.:::.:.| :|...|...|.::||||.   ..|.
  Rat   439 FPSGTECHISGWGVTETGEGS--RQLLDAKVKLIANALC-NSRQLYDHTIDDSMICAGNLQKPGS 500

  Fly   204 DACQGDSGGPLV---SGGVLV-GVVSWGYGCAYSNYPGVYADVAVLRSWVVST 252
            |.|||||||||.   .|...| |:||||..|  ...||||..|....:|:.:|
  Rat   501 DTCQGDSGGPLTCEKDGTYYVYGIVSWGQEC--GKKPGVYTQVTKFLNWIKTT 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 81/243 (33%)
Habp2NP_001001505.2 EGF_CA 71..107 CDD:238011
KR 191..275 CDD:238056
Tryp_SPc 312..551 CDD:238113 81/245 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.