DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Tmprss11g

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001008554.1 Gene:Tmprss11g / 289546 RGDID:1306446 Length:417 Species:Rattus norvegicus


Alignment Length:252 Identity:93/252 - (36%)
Similarity:130/252 - (51%) Gaps:19/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSV- 76
            |.||...|.      ..||..|.....:|:|||.|||..|.|.||.|:..:..:||:|||..:. 
  Rat   174 CGLGMEYPR------IARIADGKPAGSNSWPWQSSLQVEGIHLCGASLIGSQWLVTSAHCFDNYK 232

  Fly    77 SASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL--AT 139
            :..:..|..|.|. .:.....||.|...||.|.|:...:||||::|||.:.||.:::.:.|  ||
  Rat   233 NPKLWTVSFGRTL-GNPLTTRKVESIIIHENYAAHKHDDDIAVVKLSSPVLFSENLRTVCLPEAT 296

  Fly   140 YNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA-ASGK 203
            :.....:...|:|||...: :...|:.||.|.:.|:|...| :....||..|.:.||||. .:||
  Rat   297 FQVLPKSKVFVTGWGALKA-NGPFPNSLQEVEIEIISNDVC-NQVNVYGGAISSGMICAGFLTGK 359

  Fly   204 -DACQGDSGGPLV-----SGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTAN 254
             |||:||||||||     :...|:|:||||..|...|.||:|..|...|:|:.|..|
  Rat   360 LDACEGDSGGPLVISDNRNKWYLLGIVSWGIDCGKENKPGIYTRVTHYRNWIKSKTN 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 86/228 (38%)
Tmprss11gNP_001008554.1 SEA 48..142 CDD:279699
Tryp_SPc 185..411 CDD:214473 86/228 (38%)
Tryp_SPc 186..414 CDD:238113 86/230 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.