DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss38

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:246 Identity:80/246 - (32%)
Similarity:126/246 - (51%) Gaps:32/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHC------LQS----VSAS 79
            |.|.|:::||..|....:|||:|:..:|.|.|||||.:|..::|||||      ||:    |..:
  Rat   108 PALHGKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVLTAAHCFAREKRLQTFDMYVGIT 172

  Fly    80 VLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYN-PA 143
            .|:|....|.|.....|....:|:..     :.:..|:|:::..|::.||..:..|.|.:.| ..
  Rat   173 NLEVANKHTQWFEINQVIIHPTFEMF-----HPVGGDVALVQSKSAIVFSDYVLPICLPSSNLNL 232

  Fly   144 NGASAAVSGWGTQS----SGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASG 202
            :..|...:|||..|    :|...:.:||.     ::.:.|| ...||..|.:...|:||.  .:.
  Rat   233 SDLSCWTTGWGMVSPQGETGKDLLEAQLP-----LIPKFQC-QLLYGLTSYLLPEMLCAGDIKNM 291

  Fly   203 KDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            |:.|:||||.|||    ...:.:|:||||.|||...||||:|:|:...:|:
  Rat   292 KNVCEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLNWI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 76/239 (32%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 77/238 (32%)
Tryp_SPc 116..342 CDD:214473 76/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.