DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss34

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:264 Identity:94/264 - (35%)
Similarity:130/264 - (49%) Gaps:33/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LGGTVPEGLLP----QLDGRIVGGSATTISSFPWQISLQ------RSGSHSCGGSIYSANIIVTA 69
            ||.|:|  |.|    :|.| ||||...:.|.||||:||:      ....|.||||:.....::||
  Rat    16 LGSTMP--LTPDSGQELVG-IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTA 77

  Fly    70 AHC--LQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMV---NDIAVIRLSSSLSFS 129
            |||  |:.:.||..:|:.|.........:.||:....|..::.....   .|||:::|.|::..|
  Rat    78 AHCVELKEMEASCFRVQVGQLRLYENDQLMKVAKIIRHPKFSEKLSAPGGADIALLKLDSTVVLS 142

  Fly   130 SSIKAISL--ATYNPANGASAAVSGWGTQSSGSSSI--PSQLQYVNVNIVSQSQCASSTYGYGSQ 190
            ..:..:||  |:...::..:..|:|||. ..|...:  |..|:.|.|.||..|.|......|.|.
  Rat   143 ERVHPVSLPAASQRISSKKTWWVAGWGV-IEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSL 206

  Fly   191 IRNT------MICAAASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAVL 245
            .|.|      |:||...|:|:||.|||||||    ...|.|||||||.||...::||||..|...
  Rat   207 DRTTKIIKDDMLCAGMEGRDSCQADSGGPLVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSY 271

  Fly   246 RSWV 249
            .||:
  Rat   272 LSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 85/243 (35%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 86/244 (35%)
Tryp_SPc 33..275 CDD:214473 85/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.