DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss27

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:248 Identity:85/248 - (34%)
Similarity:130/248 - (52%) Gaps:27/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVS-ASVLQVRAGST 88
            |::..|:|||.......:|||:|:||:|:|.||||:.:...::|||||..:.| .|:.||..|:.
  Rat    32 PRMFNRMVGGEDALEGEWPWQVSIQRNGAHFCGGSLIAPTWVLTAAHCFSNTSDISIYQVLLGAL 96

  Fly    89 YWSSGG---VVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPA----NGA 146
            .....|   :...|...|:|..|.......|:|::.|...::|:..|..:.|.  :|:    :|.
  Rat    97 KLQQPGPHALYVPVKRVKSHPEYQGMASSADVALVELQVPVTFTKYILPVCLP--DPSVVFKSGM 159

  Fly   147 SAAVSGWGTQSSGSSSIPSQ--LQYVNVNIVSQSQCASSTYGYGSQ-------IRNTMICA--AA 200
            :..|:|||:.|. ...:|:.  ||.:.|.::...:| :..|...::       |::.|:||  |.
  Rat   160 NCWVTGWGSPSE-QDRLPNPRILQKLAVPLIDTPKC-NLLYSKDAEADIQLKTIKDDMLCAGFAE 222

  Fly   201 SGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            ..||||:||||||||    ...|..||:|||.|||..|.||||..||....|:
  Rat   223 GKKDACKGDSGGPLVCLVDQSWVQAGVISWGEGCARRNRPGVYIRVASHYQWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 83/241 (34%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 83/241 (34%)
Tryp_SPc 39..278 CDD:238113 83/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.