DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss3b

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:256 Identity:99/256 - (38%)
Similarity:139/256 - (54%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANII 66
            :|.:|.|:.:..|:  .:|   |...|.:||||.....:|.|:|:|| .:|.|.||||:.::..:
  Rat     1 MKALIFLAFLGAAV--ALP---LDDDDDKIVGGYTCQKNSLPYQVSL-NAGYHFCGGSLINSQWV 59

  Fly    67 VTAAHCLQSVSASVLQVRAGS---TYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSF 128
            |:||||.:    |.:|||.|.   .....|......:....|..|||||..|||.:|:|:|..:.
  Rat    60 VSAAHCYK----SRIQVRLGEHNIDVVEGGEQFIDAAKIIRHPSYNANTFDNDIMLIKLNSPATL 120

  Fly   129 SSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRN 193
            :|.:..:||.....::|....|||||...|..::.||.||.::..::|.|.|.||   |..:|.:
  Rat   121 NSRVSTVSLPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKSS---YPGKITS 182

  Fly   194 TMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVST 252
            .|.|..  ..|||:||||||||:|..|.|.||||||||||....||||..|....:|:..|
  Rat   183 NMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKGKPGVYTKVCNYVNWIQQT 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 90/223 (40%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 90/223 (40%)
Tryp_SPc 25..243 CDD:238113 91/225 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.