DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Gzma

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:261 Identity:71/261 - (27%)
Similarity:118/261 - (45%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSAVVCALGGTVPEGLLPQLDG--RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAA 70
            |:.|:..|  .:|||      |  ||:||......|.|:.:.|:......|.|::.:.|.::|||
  Rat    12 LTTVIFLL--LIPEG------GCERIIGGDTVVPHSRPYMVLLKLKPDSICAGALIAKNWVLTAA 68

  Fly    71 HCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAI 135
            ||:....:.|: :.|.|........:..|.....:..::.:|...|:.::||....:.:.::..:
  Rat    69 HCIPGKKSEVI-LGAHSIKKEPEQQILSVKKAYPYPCFDKHTHEGDLQLLRLKKKATLNKNVAIL 132

  Fly   136 SLATYNPAN------GASAAVSGWGTQSSGSSSIPSQ-LQYVNVNIVSQSQCASST-YGYGSQIR 192
            .|    |..      |....|:|||  ...:.|.||. |:.||:.::.:..|.... |.:...|.
  Rat   133 HL----PKKGDDVKPGTRCHVAGWG--RFHNKSPPSDTLREVNITVIDRKICNDEKHYNFNPVIG 191

  Fly   193 NTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGY--GCAYSNYPGVYADVAVLR-SWVVST 252
            ..||||.  ..|||:|.|||||||:..|:..|:.::|.  .|.....||:|..::... .|:..|
  Rat   192 LNMICAGNLRGGKDSCYGDSGGPLLCEGIFRGITAFGLEGRCGDPKGPGIYTLLSDKHLDWIRKT 256

  Fly   253 A 253
            |
  Rat   257 A 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 61/231 (26%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 61/231 (26%)
Tryp_SPc 29..256 CDD:238113 61/233 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.