DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klkb1

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:257 Identity:89/257 - (34%)
Similarity:123/257 - (47%) Gaps:42/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGSATTISSFPWQISLQ---RSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGS 87
            :::.|||||:.:::..:|||:|||   .|.:|.|||||.....|:|||||..           |.
  Rat   386 KINARIVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFD-----------GI 439

  Fly    88 TY---WSSGGVVAKVSSFKN------------HEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL 137
            .|   |...|.:..:|...|            |:.|..:....|||:|:|.:.|:::...|.|.|
  Rat   440 PYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICL 504

  Fly   138 ATYNPANG--ASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA 199
            .:....|.  .:..|:||| |:..|.:.  :.||...:.:|...:|......|  .|...||||.
  Rat   505 PSKADTNTIYTNCWVTGWGYTKERGETQ--NILQKATIPLVPNEECQKKYRDY--VITKQMICAG 565

  Fly   200 --ASGKDACQGDSGGPLV---SG-GVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTANS 255
              ..|.|||:||||||||   || ..|||:.|||.|||....||||..||....|::....|
  Rat   566 YKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQS 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 87/245 (36%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 87/245 (36%)
Tryp_SPc 391..621 CDD:238113 86/244 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.