DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk1c2

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:267 Identity:78/267 - (29%)
Similarity:121/267 - (45%) Gaps:38/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANI 65
            :|.:|:.:..:..|     |.|     ..|||||.....:|.|||:::  ...:.|||.:...:.
  Rat     5 ILSLVLSVGRIDAA-----PPG-----QSRIVGGYKCEKNSQPWQVAV--INEYLCGGVLIDPSW 57

  Fly    66 IVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAK----VSSFKNHEGY-----------NANTMVN 115
            ::|||||.    ::..||..|..........|:    ..||: |..|           ..:...|
  Rat    58 VITAAHCY----SNNYQVLLGRNNLFKDEPFAQRRLVRQSFR-HPDYIPLIVTNDTEQPVHDHSN 117

  Fly   116 DIAVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQC 180
            |:.::.||.....:..:|.|.|.|..|..|::...||||:.:.....:...||.||::::|..:|
  Rat   118 DLMLLHLSEPADITGGVKVIDLPTKEPKVGSTCLASGWGSTNPSEMVVSHDLQCVNIHLLSNEKC 182

  Fly   181 ASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADV 242
            ..:   |...:.:.|:||.  ..|||.|.|||||||:..|||.|:.|.| ..||....|.:||.:
  Rat   183 IET---YKDNVTDVMLCAGEMEGGKDTCAGDSGGPLICDGVLQGITSGGATPCAKPKTPAIYAKL 244

  Fly   243 AVLRSWV 249
            ....||:
  Rat   245 IKFTSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 72/236 (31%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 72/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.