DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG30289

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:279 Identity:85/279 - (30%)
Similarity:123/279 - (44%) Gaps:50/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVVCAL--GGTVPEGLLPQLDG---------RIVGGSATTISSFPWQISLQRSGSHSCGGSI 60
            :::|:||..  ...|...||.:..|         .|.||:.|.|...||.:.:.  .|..||||:
  Fly     7 VIAALVCLFIANNNVMSRLLVENCGISKDDPYVPNIFGGAKTNIQENPWMVLVW--SSKPCGGSL 69

  Fly    61 YSANIIVTAAHCLQSVSASVLQVRAGS-------TYWSSGGVVAKVSSFKN--------HEGYNA 110
            .:...::|||||   ||...|.||.|.       .|..:...:.|   |.|        ||.||.
  Fly    70 IARQFVLTAAHC---VSFEDLYVRLGDYETLDPMPYCLNNHCIPK---FYNISVDMKIVHENYNG 128

  Fly   111 NTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASA-AVSGWGTQSSGS-SSIPSQLQYVNVN 173
            .|:.||||::|:|.::.:|..::.|.|........... .|:|||....|. |.|.......|::
  Fly   129 ITLQNDIALLRMSEAVEYSDYVRPICLLVGEQMQSIPMFTVTGWGETEYGQFSRILLNATLYNMD 193

  Fly   174 IVSQSQCASSTYGYGSQIRNTMICAAASGKDACQGDSGGPLVS----GGVLV----GVVSWGYGC 230
            |   |.|   ...:..|...:.|||.:...:.|:|||||||.|    |..|:    |:||:|...
  Fly   194 I---SYC---NIKFNKQADRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSER 252

  Fly   231 AYSNYPGVYADVAVLRSWV 249
            ..:|..|||.:|:..|.|:
  Fly   253 CAANVAGVYTNVSYHREWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 77/243 (32%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 77/242 (32%)
Tryp_SPc 42..271 CDD:238113 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
21.910

Return to query results.
Submit another query.