DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG30287

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:282 Identity:84/282 - (29%)
Similarity:133/282 - (47%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQL------DG--RIVGGSATTISSFPWQISLQRSGSHSCGG 58
            :::::|::.|...:.|. |..|.||.      .|  |::.|....:.|.||.:.:...|...|||
  Fly     6 VQLLLLIALVFLKVQGQ-PHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGG 69

  Fly    59 SIYSANIIVTAAHCLQSVSASVLQVRAG------STYWSSGGVVAKVSSFKNHEGY----NANTM 113
            |:.:...::||||| :|.:.|.|.||.|      :...||.|.:.:.........|    ..|..
  Fly    70 SLITPRYVLTAAHC-KSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFR 133

  Fly   114 VNDIAVIRLSSSLSFSSSIKAISLA----TYNP---ANGASAAVSGWG-TQSSGSSSIPSQLQYV 170
            .||||::||.:::.:..:|::|.|.    |::.   .|......:||| |:|..:|.:   ||..
  Fly   134 KNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPV---LQQA 195

  Fly   171 NVNIVSQSQCASSTYGYGSQIRNTMICAAASGKDACQGDSGGPLVS----GG----VLVGVVSWG 227
            ::.....|.||..   :|.|:..:.||.|:|....|||||||||.:    |.    :|.||||  
  Fly   196 SLTHHHLSYCAQV---FGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVS-- 255

  Fly   228 YGCAYSNYPGVYADVAVLRSWV 249
            ||..:...|.||.:|....:|:
  Fly   256 YGAVHCFGPTVYTNVIHFANWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 75/244 (31%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 75/244 (31%)
Tryp_SPc 42..280 CDD:238113 75/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.