DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG30083

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:272 Identity:68/272 - (25%)
Similarity:126/272 - (46%) Gaps:33/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHS-----CGGSI 60
            :.||::|....:...  ..|....|.:..:|:.|......:.||...:.:.....     |||::
  Fly     6 IFKIILLWPGAMSQF--LEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTL 68

  Fly    61 YSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSS 125
            .....:::||||::  ...:|.||.|.  .||....|...:|:| :.:...:..|||.::|:...
  Fly    69 IHKQFVLSAAHCIK--RDQILAVRLGE--HSSSRYFAVTKAFRN-KYFTTGSYSNDIGILRIQPI 128

  Fly   126 LSFSSSIKAISLATYNPA---NGASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCASSTYG 186
            :.|::.|:.|.:.| :|.   |..:...:||| |::...|.:   |:.|.:|.::.|:|.:..: 
  Fly   129 VKFNAVIRPICIIT-DPTKVPNVKTFKAAGWGKTENETFSKV---LKTVELNELNASECYNMLW- 188

  Fly   187 YGSQIRNTMICAAASGKDACQGDSGGPLV-----SGG---VLVGVVSWGYGCAYSNYPGVYADVA 243
              ..:..:.|||.....|.|.|||||||:     .|.   |.:|::|  :|.:..|.||||..::
  Fly   189 --VNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIIS--FGSSLCNSPGVYTRLS 249

  Fly   244 VLRSWVVSTANS 255
            ....|::...::
  Fly   250 SFIDWILMVVDN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 62/235 (26%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 62/235 (26%)
Tryp_SPc 34..255 CDD:238113 62/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
11.000

Return to query results.
Submit another query.