DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk1b3

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:242 Identity:72/242 - (29%)
Similarity:117/242 - (48%) Gaps:24/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTY 89
            |.:..|:|||....::|.|||:::...|.:.|||.:...:.::|||||    :....||..|...
  Rat    23 PPVQSRVVGGYNCEMNSQPWQVAVYYFGEYLCGGVLIDPSWVITAAHC----ATDNYQVWLGRNN 83

  Fly    90 WSSGGVVAK---VSSFKNHEGYNANTM-----------VNDIAVIRLSSSLSFSSSIKAISLATY 140
            .......|:   ||....|.|:|.:.:           .||:.::.||.....:..:|.|.|...
  Rat    84 LYEDEPFAQHRLVSQSFPHPGFNQDLIWNHTRQPGDDYSNDLMLLHLSQPADITDGVKVIDLPIE 148

  Fly   141 NPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAA--SGK 203
            .|..|::...||||:.:.....:...||.||::::|..:|..:   :..::.:.|:||..  .||
  Rat   149 EPKVGSTCLASGWGSITPDGLELSDDLQCVNIDLLSNEKCVEA---HKEEVTDLMLCAGEMDGGK 210

  Fly   204 DACQGDSGGPLVSGGVLVGVVSWGYG-CAYSNYPGVYADVAVLRSWV 249
            |.|:|||||||:..|||.|:.|||:. |.....||:|..:.....|:
  Rat   211 DTCKGDSGGPLICNGVLQGITSWGFNPCGEPKKPGIYTKLIKFTPWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 70/235 (30%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 70/235 (30%)
Tryp_SPc 29..260 CDD:238113 70/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.