DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Try4

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_035776.1 Gene:Try4 / 22074 MGIID:102757 Length:246 Species:Mus musculus


Alignment Length:259 Identity:92/259 - (35%)
Similarity:140/259 - (54%) Gaps:25/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANII 66
            ::.::.|:.|..|:...|.:      |.:||||.....:|.|:|:|| .||.|.||||:.:...:
Mouse     1 MRALLFLALVGAAVAFPVDD------DDKIVGGYTCRENSVPYQVSL-NSGYHFCGGSLINDQWV 58

  Fly    67 VTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKN------HEGYNANTMVNDIAVIRLSSS 125
            |:||||.:    |.:|||.|.   .:..|:.....|.|      |..:|:.|:.|||.:|:|:|.
Mouse    59 VSAAHCYK----SRIQVRLGE---HNINVLEGNEQFVNSAKIIKHPNFNSRTLNNDIMLIKLASP 116

  Fly   126 LSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ 190
            ::.::.:..::|.:.....|....:||||...|...:.|..||.::..::.|:.|.:|   |..:
Mouse   117 VTLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEAS---YPGK 178

  Fly   191 IRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVST 252
            |.|.|||..  ..|||:||||||||:|..|.|.|:||||||||..:.||||..|.....|:.:|
Mouse   179 ITNNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQNT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 85/226 (38%)
Try4NP_035776.1 Tryp_SPc 23..239 CDD:214473 85/226 (38%)
Tryp_SPc 24..242 CDD:238113 86/228 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.