DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and F9

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:238 Identity:81/238 - (34%)
Similarity:111/238 - (46%) Gaps:27/238 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQ-----SVSASVLQVRAGSTY 89
            |:|||.......||||:.|.......|||||.:...|||||||::     :|.|....:......
Human   226 RVVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEETEHT 290

  Fly    90 WSSGGVVAKVSSFKNHEGYNA--NTMVNDIAVIRLSSSLSFSSSIKAISLATYNPAN----GASA 148
            .....|:..:.    |..|||  |...:|||::.|...|..:|.:..|.:|.....|    ..|.
Human   291 EQKRNVIRIIP----HHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKFGSG 351

  Fly   149 AVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQGDS 210
            .||||| ....|.|::  .|||:.|.:|.::.|..||   ...|.|.|.||.  ..|:|:|||||
Human   352 YVSGWGRVFHKGRSAL--VLQYLRVPLVDRATCLRST---KFTIYNNMFCAGFHEGGRDSCQGDS 411

  Fly   211 GGPLVS----GGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            |||.|:    ...|.|::|||..||.....|:|..|:...:|:
Human   412 GGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWI 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 80/236 (34%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:317114
Tryp_SPc 227..457 CDD:238113 80/237 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.