DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and ELANE

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001963.1 Gene:ELANE / 1991 HGNCID:3309 Length:267 Species:Homo sapiens


Alignment Length:262 Identity:83/262 - (31%)
Similarity:131/262 - (50%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVVCA--LGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVT 68
            :.|:.|:.|  ||||.       |...||||......::|:.:|||..|.|.||.::.:.|.:::
Human    10 LFLACVLPALLLGGTA-------LASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMS 67

  Fly    69 AAHCLQSVSASVLQVRAGSTYWS----SGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFS 129
            ||||:.:|:...::|..|:...|    :..|.|....|:|  ||:...::|||.:::|:.|.:.:
Human    68 AAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFEN--GYDPVNLLNDIVILQLNGSATIN 130

  Fly   130 SSIKAISLATYNPA------NGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYG 188
            ::::...|    ||      ||......|||.... :..|.|.||.:||.:|: |.|        
Human   131 ANVQVAQL----PAQGRRLGNGVQCLAMGWGLLGR-NRGIASVLQELNVTVVT-SLC-------- 181

  Fly   189 SQIRNTMICAAASGKDA--CQGDSGGPLVSGGVLVGVVSW--GYGCAYSNYPGVYADVAVLRSWV 249
               |.:.:|....|:.|  |.||||.|||..|::.|:.|:  | |||...||..:|.||...:|:
Human   182 ---RRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRG-GCASGLYPDAFAPVAQFVNWI 242

  Fly   250 VS 251
            .|
Human   243 DS 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 73/232 (31%)
ELANENP_001963.1 Tryp_SPc 30..245 CDD:238113 75/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.