DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prtn3

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:261 Identity:78/261 - (29%)
Similarity:122/261 - (46%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRS---GSHSCGGSIYSANIIV 67
            :||:.||   ||.|..       .:||||......|.|:..|||.|   |||.|||::.....::
Mouse    15 LLLALVV---GGAVQA-------SKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVL 69

  Fly    68 TAAHCLQSVSASVLQVRAGSTYWSSGG------VVAKVSSFKNHEGYNANTMVNDIAVIRLSSSL 126
            |||||||.:|..::.|..|:....|..      .:::|  |:|:  ||....:||:.:::|:.:.
Mouse    70 TAAHCLQDISWQLVTVVLGAHDLLSSEPEQQKFTISQV--FQNN--YNPEENLNDVLLLQLNRTA 130

  Fly   127 SFSSSIKAISLATYNP--ANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVS-----QSQCASST 184
            |....:...||...:.  :.|......|||...: .:..|..||.:||.:|:     .:.|    
Mouse   131 SLGKEVAVASLPQQDQTLSQGTQCLAMGWGRLGT-QAPTPRVLQELNVTVVTFLCREHNVC---- 190

  Fly   185 YGYGSQIRNTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGY-GCAYSNYPGVYADVAVLRSW 248
                     |::...|:|  .|.|||||||:..|:|.||.|:.. .||...:|..:|.|::...|
Mouse   191 ---------TLVPRRAAG--ICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVDW 244

  Fly   249 V 249
            :
Mouse   245 I 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 70/235 (30%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 70/235 (30%)
Tryp_SPc 30..248 CDD:238113 71/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.