DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk1b3

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_032719.1 Gene:Klk1b3 / 18050 MGIID:97322 Length:261 Species:Mus musculus


Alignment Length:274 Identity:80/274 - (29%)
Similarity:124/274 - (45%) Gaps:49/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAH 71
            |:..:..:|||.   ...|.:..|||||.....:|.||.:::.|...:.|||.:...|.::||||
Mouse     4 LILFLALSLGGI---DAAPPVQSRIVGGFKCEKNSQPWHVAVYRYTQYLCGGVLLDPNWVLTAAH 65

  Fly    72 CLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKN--------------HEGYNANTM--------- 113
            |...          ....|     :.|.:.||:              |.|:|.:.|         
Mouse    66 CYDD----------NYKVW-----LGKNNLFKDEPSAQHRFVSKAIPHPGFNMSLMRKHIRFLEY 115

  Fly   114 --VNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVS 176
              .||:.::|||.....:.::|.|:|.|..|..|::...||||:.:.........|..||:.::.
Mouse   116 DYSNDLMLLRLSKPADITDTVKPITLPTEEPKLGSTCLASGWGSITPTKFQFTDDLYCVNLKLLP 180

  Fly   177 QSQCASSTYGYGSQIRNTMICAAA--SGKDACQGDSGGPLVSGGVLVGVVSWGY-GCAYSNYPGV 238
            ...||.:   :..::.:.|:||..  .|||.|:|||||||:..|||.|:.|||: .|...:.|||
Mouse   181 NEDCAKA---HIEKVTDAMLCAGEMDGGKDTCKGDSGGPLICDGVLQGITSWGHTPCGEPDMPGV 242

  Fly   239 YADVAVLRSWVVST 252
            |..:....||:..|
Mouse   243 YTKLNKFTSWIKDT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 73/246 (30%)
Klk1b3NP_032719.1 Tryp_SPc 25..256 CDD:238113 73/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5403
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.