DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk1b8

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_032483.1 Gene:Klk1b8 / 16624 MGIID:892018 Length:261 Species:Mus musculus


Alignment Length:268 Identity:77/268 - (28%)
Similarity:125/268 - (46%) Gaps:29/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANII 66
            ::.:||..|:  :|||.   ...|.|..|:|||.....:|.|||:::..:..|.|||.:...|.:
Mouse     1 MRFLILFLAL--SLGGI---DAAPPLQSRVVGGFNCEKNSQPWQVAVYDNKEHICGGVLLERNWV 60

  Fly    67 VTAAHCLQSVSASVLQVRAGSTYWSSGGVVAK---VSSFKNHEGYNANTMV-----------NDI 117
            :|||||.    ....:|..|..........|:   ||....|.|:|.:.:.           ||:
Mouse    61 LTAAHCY----VDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLTLKEIPPGADFSNDL 121

  Fly   118 AVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCAS 182
            .::|||.....:.::|.|:|.|.....|::...||||:.:......|..||.|.:.::....|..
Mouse   122 MLLRLSKPADITDAVKPITLPTKESKLGSTCLASGWGSITPTKWQKPDDLQCVFLKLLPIKNCIE 186

  Fly   183 STYGYGSQIRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAV 244
            :   :..::.:.|:||.  :.||:.|:|||||||:...||.|:.|.| ..|.....|.:|.::..
Mouse   187 N---HNVKVTDVMLCAGEMSGGKNICKGDSGGPLICDSVLQGITSTGPIPCGKPGVPAMYTNLIK 248

  Fly   245 LRSWVVST 252
            ..||:..|
Mouse   249 FNSWIKDT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 67/235 (29%)
Klk1b8NP_032483.1 Tryp_SPc 24..253 CDD:214473 67/235 (29%)
Tryp_SPc 25..256 CDD:238113 67/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.