DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CTRL

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:258 Identity:96/258 - (37%)
Similarity:138/258 - (53%) Gaps:18/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQ-RSGSHSCGGSIYSANI 65
            |.:|:|.|:..|.:....|.....|   |||.|....:.|:|||:||| .||.|.||||:.|.:.
Human     8 LSLVLLGSSWGCGIPAIKPALSFSQ---RIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSW 69

  Fly    66 IVTAAHCLQSVSASVLQVRAGSTYWSSGG---VVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLS 127
            :||||||  :||.....|..|....||..   .|..||....|..:|:.||.||:.:::|:|...
Human    70 VVTAAHC--NVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQ 132

  Fly   128 FSSSIKAISLATYNPA--NGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ 190
            :::.|..:.||:.|.|  .|.:...:|||..|...:..|:.||.|.:.:|:.:||...   :||.
Human   133 YTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQY---WGSS 194

  Fly   191 IRNTMICAAASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            |.::||||..:|..:||||||||||    :..||:|:||||........|.||..|:...:|:
Human   195 ITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 88/228 (39%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 88/229 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.