DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk1b22

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_034244.1 Gene:Klk1b22 / 13646 MGIID:95291 Length:259 Species:Mus musculus


Alignment Length:269 Identity:78/269 - (28%)
Similarity:127/269 - (47%) Gaps:33/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANII 66
            ::.:||.  :..:|||.   ...|.:..||:||.....:|.|||:::.....:.|||.:...|.:
Mouse     1 MRFLILF--LTLSLGGI---DAAPPVQSRILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWV 60

  Fly    67 VTAAHCLQSV------SASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNAN---------TMVND 116
            :|||||.:..      ...:.|....:.:    .:|:|  ||. |..:|.:         .:.||
Mouse    61 LTAAHCYEDKYNIWLGKNKLFQDEPSAQH----RLVSK--SFP-HPDFNMSLLQSVPTGADLSND 118

  Fly   117 IAVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCA 181
            :.::|||.....:..:|.|.|.|..|..|::...||||:.:......|:.||.|::.:.....|.
Mouse   119 LMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCV 183

  Fly   182 SSTYGYGSQIRNTMICAAA--SGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVA 243
            .:   :..::.:.|:||..  .|||.|:|||||||:..|||.|:.||| ..|...|.|.:|..:.
Mouse   184 KA---HILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLI 245

  Fly   244 VLRSWVVST 252
            ...||:..|
Mouse   246 KFTSWIKDT 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 70/236 (30%)
Klk1b22NP_034244.1 Tryp_SPc 24..251 CDD:214473 70/236 (30%)
Tryp_SPc 25..254 CDD:238113 70/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.