DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP001198

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_321961.2 Gene:AgaP_AGAP001198 / 1281971 VectorBaseID:AGAP001198 Length:260 Species:Anopheles gambiae


Alignment Length:267 Identity:81/267 - (30%)
Similarity:130/267 - (48%) Gaps:32/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTV-PEGLLPQLDGRIVGGSATTISSFPWQISLQ---RSGS---HSCGG 58
            |.::..::...:.|||.:: |.         |:.|:...:..||:|:|||   .:||   |.|.|
Mosquito     1 MKRLAFIIIPALIALGHSIRPP---------IIEGTEANLHEFPYQVSLQWNFNNGSRARHFCSG 56

  Fly    59 SIYSANIIVTAAHCLQSVSA-SVLQVRAG---STYWSSGGVVAKVSSFKNHEGYNANTMVNDIAV 119
            ||.:...|:||||||:..:. ...:|.||   ..:..:|.....|:.::.||.|:.:.:..||.|
Mosquito    57 SIINQRWILTAAHCLEEYTKDGWFEVVAGVNNIAHEEAGAQRRNVTRYEQHESYDLSAIRYDIGV 121

  Fly   120 IRLSSSLSFSSSIKAISLATYNP-ANGASAAVSGWGTQSSGSSSI-PSQLQYVNVNIVSQSQCAS 182
            ::||..|..:.:||.:.|||.:. .:...|..:|||:.|.....| |.:|..||:.:.::..|  
Mosquito   122 LQLSHPLDLTRNIKTMRLATKDTLIHQKIAKFAGWGSISKTWEDIYPDKLMKVNLILRTEEDC-- 184

  Fly   183 STYGYGSQIRNTMICAAA-SGKDACQGDSGGPL---VSGGVL-VGVVSWGYGCAYSNYPGVYADV 242
            .|.|   :|..|.|||.. .....|..||||||   :.|..: :||:|:|.....:..|.||:.|
Mosquito   185 QTIG---KIDETQICAGGYKNVSGCTADSGGPLTVTIDGEQMQIGVLSYGEKPCQARLPIVYSSV 246

  Fly   243 AVLRSWV 249
            .....|:
Mosquito   247 MYFHDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 75/235 (32%)
AgaP_AGAP001198XP_321961.2 Tryp_SPc 23..255 CDD:238113 76/236 (32%)
Tryp_SPc 23..253 CDD:214473 75/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.