DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP001244

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_321898.3 Gene:AgaP_AGAP001244 / 1281920 VectorBaseID:AGAP001244 Length:279 Species:Anopheles gambiae


Alignment Length:281 Identity:92/281 - (32%)
Similarity:138/281 - (49%) Gaps:35/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGT------------VPEGLLPQLDGR-------------IVGGSATTISS 41
            :.:.:::.||..|:...            :|.| ..|:|.|             ||||...:|.:
Mosquito     1 MNVFVVICAVALAVASAQDVASTVYGRRMLPAG-AQQVDDRAQQSMGSVGSLKKIVGGEPVSIET 64

  Fly    42 FPWQISLQRSGSHSCGGSIYSANIIVTAAHCL-QSVSASVLQVRAGSTYWSSGGVVAKVSSFKNH 105
            ..:|:||:....|.||.||.|:...:|||||| .......:.:.||:...|:||.:...:....|
Mosquito    65 HVYQLSLRSYDYHICGASIISSVWALTAAHCLFPDPDPRTISLLAGTGSQSTGGRIYNATRIIIH 129

  Fly   106 EGYNANTMVNDIAVIRLSSSLSFSSS--IKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQ 168
            ..|..:||.||:||||:::..|..::  |..:.|. |.|..|..|.|:|||.||.|:.. ...|.
Mosquito   130 PMYAPSTMDNDVAVIRVNTHFSGPNTGYIGVVPLG-YEPMAGVRAIVTGWGRQSEGAKQ-SMTLA 192

  Fly   169 YVNVNIVSQSQCASSTYGYGSQIRNTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYS 233
            .|.:.||.:::|.....|.  .:...||||...|||:|.|||||||||||..:|:||||......
Mosquito   193 GVEIPIVDKAECMDQWSGV--LVSPQMICAGELGKDSCNGDSGGPLVSGGRQIGIVSWGSTKCGG 255

  Fly   234 NYPGVYADV--AVLRSWVVST 252
            ....:|.::  |.:|:::.||
Mosquito   256 PLAAIYTNLGNAAIRTFISST 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 83/236 (35%)
AgaP_AGAP001244XP_321898.3 Tryp_SPc 53..266 CDD:214473 80/216 (37%)
Tryp_SPc 54..276 CDD:238113 82/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.