DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP001964

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_321098.5 Gene:AgaP_AGAP001964 / 1281159 VectorBaseID:AGAP001964 Length:363 Species:Anopheles gambiae


Alignment Length:270 Identity:74/270 - (27%)
Similarity:120/270 - (44%) Gaps:47/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGS----HSCGGSIYSANIIVTAAH 71
            :|||.......|.:.|.|     .:......|||...:..:.:    :.|||::..:.:::|.||
Mosquito    96 IVCAARNNNGIGHVEQKD-----KTRAKYGEFPWMAFVYTAQADYELYLCGGTLVHSKVVITIAH 155

  Fly    72 CLQSVSASVLQVRAGSTYW-----------SSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSS 125
            |:::.:||.|:||.|.  |           ....|:|.|:    |..:.:..::||||::.|...
Mosquito   156 CIENRTASELRVRLGE--WDLEHMVEIYPPQDRAVIAAVT----HPQFYSELLLNDIAILFLDEH 214

  Fly   126 LSFSSSIKAISLATYNPANG----ASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQC----AS 182
            :.|:   :.:.:|...|.|.    .....:|||....|.:|  |.|:...:.||...||    ..
Mosquito   215 VDFT---EVVGIACLPPQNANFDHKRCLFTGWGEDERGRNS--SVLKRTKLPIVPNGQCQRVLRR 274

  Fly   183 STYGYGSQIRNTMICAAA-SGKDACQGDSGGPLV-------SGGVLVGVVSWGYGCAYSNYPGVY 239
            .......::....:||.. ||||||:||.|.|||       :...:||:|::||.|.....||||
Mosquito   275 HLLNRSFRLHQGFLCAGGESGKDACRGDGGSPLVCPIPQSENQYYVVGLVAFGYECGTQGVPGVY 339

  Fly   240 ADVAVLRSWV 249
            .:|...|.|:
Mosquito   340 VNVPHYRDWI 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 67/249 (27%)
AgaP_AGAP001964XP_321098.5 Tryp_SPc 117..350 CDD:238113 68/244 (28%)
Tryp_SPc 117..349 CDD:214473 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.