DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP009828

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_318940.4 Gene:AgaP_AGAP009828 / 1279246 VectorBaseID:AGAP009828 Length:232 Species:Anopheles gambiae


Alignment Length:227 Identity:58/227 - (25%)
Similarity:108/227 - (47%) Gaps:6/227 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVGGSATTISSFPWQISLQRSGSHS--CGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWSSG 93
            ||||.|:...:.|:.::::.:.:.:  |.|.:.....|:|.|.|:...:|:.|::..||....:.
Mosquito     7 IVGGHASLPGAAPYIVAIKTTSASTLLCAGVLIKTTWILTTAQCVNDKTAADLKILTGSHRLLTS 71

  Fly    94 GVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGWGTQSS 158
            ..:..:|..:.|..|...:...::|:::||:::|.||.:..:.|......:|......|||..|.
Mosquito    72 KELLLISKIERHPSYKPASSEYNLALLQLSAAVSLSSRVATVVLNDEPIISGIPVVFFGWGASSY 136

  Fly   159 GSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAASGKDACQGDSGGPLVSGGV--LV 221
            ||.:..:.||.:....:|.|.|.:.: |......:.:......|:.||..|..||||....  ||
Mosquito   137 GSLAYSNVLQSLYKRTLSTSDCRAQS-GLVDLSADNICTIGQPGQAACTHDEAGPLVRYDTQKLV 200

  Fly   222 GVVSWGYGCAYSNYPGVYADVAVLRSWVVSTA 253
            |:.::|..|. ...|.|:.:|...::|:.|.|
Mosquito   201 GLFNYGSQCT-GRSPDVFVNVLTHKTWIDSIA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 55/221 (25%)
AgaP_AGAP009828XP_318940.4 Tryp_SPc 7..230 CDD:238113 56/224 (25%)
Tryp_SPc 7..227 CDD:214473 55/221 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.