DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP011477

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_317829.4 Gene:AgaP_AGAP011477 / 1278364 VectorBaseID:AGAP011477 Length:276 Species:Anopheles gambiae


Alignment Length:258 Identity:109/258 - (42%)
Similarity:151/258 - (58%) Gaps:26/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVVCALG-------------GTVP---EGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHS 55
            |::..|||:.             .|.|   .||:..  .|:||||.|||.:.|:|:||:|...||
Mosquito    14 LVALCVCAMSLVSHHTVRSSPIKRTSPICKYGLINM--ARVVGGSDTTIEAHPYQVSLRRLHKHS 76

  Fly    56 CGGSIYSANIIVTAAHCLQ--SVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIA 118
            |||:|.:.|.|:|||||:.  .:..|..:||||||:.:.||.:..|:....|..||..|:..||:
Mosquito    77 CGGAILNTNTILTAAHCVDYPELVPSDFEVRAGSTFRNEGGQLITVAQIHTHPSYNDWTLEWDIS 141

  Fly   119 VIRLSSSLSFSSSIKAISLAT--YNPANGASAAVSGWGT-QSSGSSSIPSQLQYVNVNIVSQSQC 180
            |::|.|||..|.:::.|||..  ....:|.|.:::|||: ...|.|:  :.||:|.:.|||.|:|
Mosquito   142 VLKLVSSLQLSPTVQPISLPDRGLTIPDGTSVSLAGWGSLYYQGPST--NHLQHVMLPIVSNSRC 204

  Fly   181 ASSTYGYGSQIRNTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVA 243
            ..: |...:.|....|||...||||||||||||||....:||:||||||||:.|||.||..|:
Mosquito   205 GMA-YKNFAPILPFHICAGHKGKDACQGDSGGPLVYQSRVVGIVSWGYGCAFENYPSVYTRVS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 101/219 (46%)
AgaP_AGAP011477XP_317829.4 Tryp_SPc 51..272 CDD:214473 101/219 (46%)
Tryp_SPc 52..272 CDD:238113 100/218 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm49678
Panther 1 1.100 - - LDO PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.