DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and TRY6_ANOGA

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_317175.2 Gene:TRY6_ANOGA / 1277692 VectorBaseID:AGAP008290 Length:273 Species:Anopheles gambiae


Alignment Length:234 Identity:92/234 - (39%)
Similarity:131/234 - (55%) Gaps:7/234 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDG-RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGST 88
            |.|.| |||||....||..|:|||||.:|.|.|||||.::..|:|||||:...|.....||.||:
Mosquito    40 PYLAGKRIVGGFVIDISDAPYQISLQYNGKHHCGGSILNSKWILTAAHCIDLYSEVKPTVRVGSS 104

  Fly    89 YWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPA--NGASAAVS 151
            ..::||.|..:.....|.|:::.....|||::.|...|:|:.:::.:.|...:..  .|....||
Mosquito   105 EHAAGGTVLHLLRIVPHPGHSSGGNNYDIALLELECELTFNDNVQPVQLPEQDDPIDEGTMGIVS 169

  Fly   152 GWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPL 214
            |||...| ::.:.:.|:..||..|:|.:|..:...||. :...|.||.  ..|...|:.|||||.
Mosquito   170 GWGMTMS-AADLNAILRATNVPTVNQQECNQAYQSYGG-VAEQMFCAGYKQGGTGTCRNDSGGPF 232

  Fly   215 VSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTA 253
            |:.|.|:|||||.:.||.:.||||||.||.:|.|:..|:
Mosquito   233 VAEGKLIGVVSWSHECALAGYPGVYARVASVRDWIRETS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 87/222 (39%)
TRY6_ANOGAXP_317175.2 Tryp_SPc 46..267 CDD:214473 87/222 (39%)
Tryp_SPc 47..270 CDD:238113 87/224 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.