DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and TRY4_ANOGA

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_317173.2 Gene:TRY4_ANOGA / 1277690 VectorBaseID:AGAP008292 Length:275 Species:Anopheles gambiae


Alignment Length:268 Identity:113/268 - (42%)
Similarity:150/268 - (55%) Gaps:23/268 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVILLSAVVCALGGT-----VPEGL---LPQ-----LDGRIVGGSATTISSFPWQISLQRSGSHS 55
            :.:||:.|.||....     ||..|   ||:     .:.|||||....::..|:|:|||||..|.
Mosquito     9 LAVLLAVVACAQAHASHQRRVPYPLPRFLPRPHHTVSNHRIVGGFEIDVAETPYQVSLQRSKRHI 73

  Fly    56 CGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVI 120
            ||||:.|...|:|||||......:.|.||.||:..:|||.|..|:....|..|:..|:..|.:::
Mosquito    74 CGGSVLSGKWILTAAHCTDGSQPASLTVRLGSSRHASGGSVIHVARIVQHPDYDQETIDYDYSLL 138

  Fly   121 RLSSSLSFSSSIKAISLATYNPA--NGASAAVSGWGTQSSGSSSIPSQ--LQYVNVNIVSQSQCA 181
            .|.|.|:||:.::.|:|...:.|  :|....|||||   |..|:|.|.  |:..||..|:|.:| 
Mosquito   139 ELESVLTFSNKVQPIALPEQDEAVEDGIMTIVSGWG---STKSAIESNAILRAANVPTVNQDEC- 199

  Fly   182 SSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAV 244
            :..|.....|...|:||.  ..||||||||||||||:...|:||||||.|||...||||||.|||
Mosquito   200 NQAYHKSEGITERMLCAGYQQGGKDACQGDSGGPLVAEDKLIGVVSWGAGCAQPGYPGVYARVAV 264

  Fly   245 LRSWVVST 252
            :|.|:..|
Mosquito   265 VRDWIRET 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 101/224 (45%)
TRY4_ANOGAXP_317173.2 Tryp_SPc 48..269 CDD:214473 101/224 (45%)
Tryp_SPc 49..272 CDD:238113 101/226 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.