DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and TRY7_ANOGA

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_317172.2 Gene:TRY7_ANOGA / 1277689 VectorBaseID:AGAP008293 Length:267 Species:Anopheles gambiae


Alignment Length:256 Identity:106/256 - (41%)
Similarity:146/256 - (57%) Gaps:13/256 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVILLSAVVCALG-----GTVPEGLLPQLDG-RIVGGSATTISSFPWQISLQRSGSHSCGGSIYS 62
            :.:|::.|.||..     ..:.:...|...| |||||....:|..|:|:|||...||.||||:.:
Mosquito     9 LTVLIAVVACARAQPSRRHPLVQPRSPHGSGHRIVGGFEINVSDTPYQVSLQYINSHRCGGSVLN 73

  Fly    63 ANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLS 127
            :..::|||||...:.|..|.||.||:..:|.|.|..|:....|..||......|.|::.|.|.|:
Mosquito    74 SKWVLTAAHCTDGLQAFTLTVRLGSSRHASSGTVVNVARIVEHPKYNEYNTDYDYALLELESELT 138

  Fly   128 FSSSIKAISLATYNPA--NGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ 190
            ||..::.::|...:.|  .|....|||||:..|.:.| .:.|:..||..|.|.:|..: |.:.: 
Mosquito   139 FSDVVQPVALPEQDEAVDAGTMTIVSGWGSTKSATES-NAILRAANVPTVDQEECREA-YSHDA- 200

  Fly   191 IRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            |.:.|:||.  ..||||||||||||||:.|.|:||||||.|||...||||||.|||:|:||
Mosquito   201 ITDRMLCAGYQQGGKDACQGDSGGPLVADGKLIGVVSWGSGCAQPGYPGVYARVAVVRNWV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 98/222 (44%)
TRY7_ANOGAXP_317172.2 Tryp_SPc 41..261 CDD:214473 98/222 (44%)
Tryp_SPc 42..264 CDD:238113 99/223 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.