DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP006674

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_316711.4 Gene:AgaP_AGAP006674 / 1277264 VectorBaseID:AGAP006674 Length:306 Species:Anopheles gambiae


Alignment Length:258 Identity:75/258 - (29%)
Similarity:120/258 - (46%) Gaps:44/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQR---SGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGST--- 88
            |||.|...|...||:|::|..   :|:..||.:|.:.|.::|||||:...:.   ||..|.|   
Mosquito    59 RIVNGQQATPGQFPYQVALLSNFGTGTGLCGATIITNNFLLTAAHCVVGGNG---QVAIGGTAIL 120

  Fly    89 ---------------YWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLA 138
                           .::..|:..       |..||.:|:.||||.:||::..:|::.::.|.|.
Mosquito   121 GAHDRTVVEPTQQRIAFAQSGIFV-------HPSYNPSTIRNDIATVRLNTPATFNARVQPIDLP 178

  Fly   139 TYNPAN---GASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICA-A 199
            ..:.|.   |.....||:|..|..|::....:.:....|:|.:||.|.......|.:|  :|. |
Mosquito   179 ARSDARTFAGVEGTASGFGRTSDASTATSPVVMFTRNPILSNAQCNSFWSTAVVQAQN--VCLDA 241

  Fly   200 ASGKDACQGDSGGPLV--SGG--VLVGVVSW--GYGCAYSNYPGVYADVAVLRSWVVSTANSI 256
            ..|:..|.|||||||.  .||  :.||:.|:  ..||| |..|.|:..::..|.|:...::.:
Mosquito   242 TGGRSPCNGDSGGPLAVQDGGRSLEVGIASFVSAAGCA-SGAPSVWVRISFFRDWIQQNSDYV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 74/249 (30%)
AgaP_AGAP006674XP_316711.4 Tryp_SPc 59..296 CDD:214473 74/249 (30%)
Tryp_SPc 60..299 CDD:238113 74/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.