DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP006539

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_316577.4 Gene:AgaP_AGAP006539 / 1277138 VectorBaseID:AGAP006539 Length:270 Species:Anopheles gambiae


Alignment Length:236 Identity:84/236 - (35%)
Similarity:125/236 - (52%) Gaps:32/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISLQRS-GSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWS 91
            |.|||.|:..:|..:|:.:||:.| |.|||||||.|....:|||||:.|.:..:..::.|.|..|
Mosquito    33 DRRIVNGTDASILDYPFMLSLRGSTGGHSCGGSILSELWAMTAAHCVSSTTTYLQTIQVGRTNIS 97

  Fly    92 SG------GVVAKVSSFKNHEGYNA-NTMVNDIAVIRLSSSLSFSSSIKAISLATYNPA------ 143
            ..      |:...::    |..|:: |:.:||||:::|...:.||.|::.:.|    ||      
Mosquito    98 RDVDDSVYGIAQVIA----HPQYDSRNSHLNDIALLKLQRPIVFSESVQPVRL----PAPMFEVE 154

  Fly   144 ---NGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGK 203
               :.....:.|||..::|.|: |:.||.|:..:|...:|.:...|   .|..:.||||  ..||
Mosquito   155 DDLDDLGVTLIGWGLLATGGSA-PATLQRVDYYVVPNEECNAIHTG---TIYPSHICAAIPGGGK 215

  Fly   204 DACQGDSGGPLVSGGVLVGVVSWGY-GCAYSNYPGVYADVA 243
            ..|.|||||||:..||.||:|||.. .||.:.||||...|:
Mosquito   216 GQCSGDSGGPLLHHGVQVGIVSWSVKPCAVAPYPGVLTKVS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 83/234 (35%)
AgaP_AGAP006539XP_316577.4 Tryp_SPc 35..262 CDD:214473 83/234 (35%)
Tryp_SPc 36..265 CDD:238113 82/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.