DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP006486

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_316523.4 Gene:AgaP_AGAP006486 / 1277090 VectorBaseID:AGAP006486 Length:287 Species:Anopheles gambiae


Alignment Length:266 Identity:71/266 - (26%)
Similarity:120/266 - (45%) Gaps:24/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCA---LGGTVPEGLLPQLDGRIVGGSATTISSFPWQISL---QRSGSHSCGGS 59
            :|.:.:||:..|..   :.....||..|.|. .|.||:......||..:::   ....:..|||.
Mosquito     9 LLALALLLATTVSGQRYMLAEQEEGYEPFLP-FIAGGTNAVNGQFPSIVAVGLPAPPNNAFCGGV 72

  Fly    60 IYSANIIVTAAHCLQS-----VSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAV 119
            |.:.|.::|||.|:.:     :.|:.|.:.:|....:.|.....:::...|..||..|..::|||
Mosquito    73 ILNENHVLTAARCVLTPQNTLLFANQLNILSGMLQLNFGAPRIGITAVYVHPQYNPFTFEHNIAV 137

  Fly   120 IRLSSSLSFS-SSIKAISLATYNPA---NGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQC 180
            :|.||:..|. ..:..:..|.:...   :|....|.||    :..::.|.| |::|..|:::..|
Mosquito   138 LRTSSNFFFPVVPVPNVDFAQFYEEIAFDGQPCQVVGW----NNGTATPVQ-QFINAPILNRDTC 197

  Fly   181 ASSTYGYGSQIRNTMICAAA--SGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVA 243
            .......|: ||.:|:||..  :|...|..:.|..|...|.|.|::|.|.||..:|.||||..:.
Mosquito   198 NGLAVHLGN-IRESMVCAGVTNAGPGVCASNLGTGLFCEGRLAGILSTGLGCGQANNPGVYTQIR 261

  Fly   244 VLRSWV 249
            ....|:
Mosquito   262 YYLPWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 62/232 (27%)
AgaP_AGAP006486XP_316523.4 Tryp_SPc 41..270 CDD:238113 63/233 (27%)
Tryp_SPc 41..267 CDD:214473 62/231 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.